PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00363.1_g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 504aa    MW: 56321.7 Da    PI: 8.4284
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00363.1_g00017.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.8e-1685131148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WTteEde l +av  +  ++Wk+Ia+ ++  Rt+ qc +rwqk+l
  Rsa1.0_00363.1_g00017.1  85 KGGWTTEEDETLRQAVCTYNAKSWKKIAEFFP-DRTEVQCLHRWQKVL 131
                              688*****************************.************986 PP

2Myb_DNA-binding61.22.2e-19137183148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+WT+eEde++v++v ++G+  W+tIa+ ++ gR +kqc++rw+++l
  Rsa1.0_00363.1_g00017.1 137 KGPWTQEEDEKIVELVGKYGPAKWSTIAKSLQ-GRIGKQCRERWHNHL 183
                              79******************************.*************97 PP

3Myb_DNA-binding57.43.4e-18189232146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              + +WT+eE++ l +a++ +G++ W+ Ia+ ++ gRt++++k++w++
  Rsa1.0_00363.1_g00017.1 189 KEAWTPEEELALMNAHRVHGNK-WAEIAKVLP-GRTDNSIKNHWNS 232
                              579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.2180131IPR017930Myb domain
SuperFamilySSF466893.88E-1982145IPR009057Homeodomain-like
SMARTSM007171.3E-1384133IPR001005SANT/Myb domain
PfamPF002491.6E-1485131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2187143IPR009057Homeodomain-like
CDDcd001671.36E-1188131No hitNo description
PROSITE profilePS5129432.137132187IPR017930Myb domain
SuperFamilySSF466893.37E-32134230IPR009057Homeodomain-like
SMARTSM007176.4E-17136185IPR001005SANT/Myb domain
PfamPF002491.6E-17137183IPR001005SANT/Myb domain
CDDcd001676.64E-14139183No hitNo description
Gene3DG3DSA:1.10.10.607.9E-27144190IPR009057Homeodomain-like
PROSITE profilePS5129423.02188238IPR017930Myb domain
SMARTSM007177.1E-17188236IPR001005SANT/Myb domain
PfamPF002491.2E-16189232IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-23191237IPR009057Homeodomain-like
CDDcd001672.28E-12191234No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MSLNLNPSSS SSPDEGERRG GEEVKMEEDE CVENKQSTAA SCSSVSEGSG SGSSFLLKSP  60
PAVASPPPTL SPTHRRTSGP IRRAKGGWTT EEDETLRQAV CTYNAKSWKK IAEFFPDRTE  120
VQCLHRWQKV LNPDLIKGPW TQEEDEKIVE LVGKYGPAKW STIAKSLQGR IGKQCRERWH  180
NHLNPGINKE AWTPEEELAL MNAHRVHGNK WAEIAKVLPG RTDNSIKNHW NSSLKKKSEF  240
YLANGALPPS AAKTGVLDSA ATKRPFFYRR DSVTVAQTSS SGTIQINKPD EDRKDQAASP  300
LTGVSEYGRS PQLPNPEPSP ENGYHLYYKN PPQTEYSMAS EADKQRMYGY ECGCSPSASP  360
VIFFTPPPPS RKEYINGLRP TSPESYLREA ARTFPNTPSI FRKRRRRTVV VVSDNDNKAT  420
ERDEEAKEVV VAVQKVVNET ERSPDTEQEK QSDGSNAYNL SPPYRIRSKR TAVFKSRQLE  480
FISPEEAKAA DDETKSSEKD KVLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-69842375158MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-69842375158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1401405RKRRR
2401407RKRRRRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009146933.10.0PREDICTED: myb-like protein B
TrEMBLM4ELU20.0M4ELU2_BRARP; Uncharacterized protein
STRINGBra029762.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.20.0myb domain protein 3r-3